Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYCP2 Rabbit pAb (APR22684N)

Product Specifications

Background

The synaptonemal complex is a proteinaceous structure that links homologous chromosomes during the prophase of meiosis. The protein encoded by this gene is a major component of the synaptonemal complex and may bind DNA at scaffold attachment regions. The encoded protein requires synaptonemal complex protein 3, but not 1, for inclusion in the synaptonemal complex.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYCP2 Rabbit pAb (APR22677N8) .

Synonyms

SYCP2; SCP-2; SCP2

Gene ID

10388

UniProt

Q9BX26

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 175kDa Observed MW: 176kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10388

Uniprot URL

https://www.uniprot.org/uniprot/Q9BX26

AA Sequence

EIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFVDFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDRLLKDMLEEELLNVRRELMSVFMSHERNANV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF31, CT (RNF31, ZIBRA, E3 ubiquitin-protein ligase RNF31, HOIL-1-interacting protein, RING finger protein 31, Zinc in-between-RING-finger ubiquitin-associated domain protein) (MaxLight 750) discontinued
041142-ML750 100 µL

RNF31, CT (RNF31, ZIBRA, E3 ubiquitin-protein ligase RNF31, HOIL-1-interacting protein, RING finger protein 31, Zinc in-between-RING-finger ubiquitin-associated domain protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rnc Protein (aa 1-225) (strain ATCC 39315 / El Tor Inaba N16961)
VAng-Cr3495-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae rnc Protein (aa 1-225) (strain ATCC 39315 / El Tor Inaba N16961)

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase XIV/CA14 Antibody (515) [DyLight 405]
NBP2-89510V 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase XIV/CA14 Antibody (515) [DyLight 405]

Sign In for Pricing
View Details
RGD1308612 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV634173 1.0 µg DNA

RGD1308612 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
SRPK2 (NM_182691) Human Tagged ORF Clone Lentiviral Particle
RC205134L4V 200 µL

SRPK2 (NM_182691) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Domestic Spherical SAX, 20-40μm, 100Å,12g
12013050 18 PCS

Domestic Spherical SAX, 20-40μm, 100Å,12g

Sign In for Pricing
View Details