Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLF2 Rabbit pAb (APR22664N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MLF2 Rabbit pAb (APR22664N) .

Synonyms

MLF2; NTN4

Gene ID

8079

UniProt

Q15773

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8079

Uniprot URL

https://www.uniprot.org/uniprot/Q15773

AA Sequence

MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV656853 1.0 µg DNA

GRN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 650)
MBS6504372-01 0.1 mL

UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 650)

Sign In for Pricing
View Details
UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 650)
MBS6504372-02 5x 0.1 mL

UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human C2orf81 shRNA (UAS) - Lentiviral human C2orf81 shRNA (UAS, RFP) plasmid
GTR15158113 1 Vial

Lentiviral human C2orf81 shRNA (UAS) - Lentiviral human C2orf81 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
P-Toluic acid-d7
HY-76547S1-01 5 mg

P-Toluic acid-d7

Sign In for Pricing
View Details
P-Toluic acid-d7
HY-76547S1-02 10 mg

P-Toluic acid-d7

Sign In for Pricing
View Details