Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA1 Rabbit pAb (APR22641N)

Product Specifications

Background

This gene encodes the alpha 1 subunit of integrin receptors. This protein heterodimerizes with the beta 1 subunit to form a cell-surface receptor for collagen and laminin. The heterodimeric receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. The alpha 1 subunit contains an inserted (I) von Willebrand factor type I domain which is thought to be involved in collagen binding.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ITGA1 Rabbit pAb (APR22636N4) .

Synonyms

ITGA1; CD49a; VLA1

Gene ID

3672

UniProt

P56199

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 130kDa Observed MW: 200kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3672

Uniprot URL

https://www.uniprot.org/uniprot/P56199

AA Sequence

ATVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFNLTDPENGPVLDDSLPNSVHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zalcitabine 100mg
A11005-100 100 mg

Zalcitabine 100mg

Sign In for Pricing
View Details
RGD1305679 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
38946116 3x 1.0 µg

RGD1305679 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)
MBS1203847-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)
MBS1203847-02 0.02 mg (Yeast)

Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)
MBS1203847-03 0.1 mg (E-Coli)

Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)
MBS1203847-04 0.1 mg (Yeast)

Recombinant Clostridium botulinum Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details