Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCD2 Rabbit pAb (APR22619N)

Product Specifications

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown; however this protein is speculated to function as a dimerization partner of ABCD1 and/or other peroxisomal ABC transporters. Mutations in this gene have been observed in patients with adrenoleukodystrophy, a severe demyelinating disease. This gene has been identified as a candidate for a modifier gene, accounting for the extreme variation among adrenoleukodystrophy phenotypes. This gene is also a candidate for a complement group of Zellweger syndrome, a genetically heterogeneous disorder of peroxisomal biogenesis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABCD2 Rabbit pAb (APR22619N) .

Synonyms

ABCD2; ABC39; ALDL1; ALDR; ALDRP; hALDR

Gene ID

225

UniProt

Q9UBJ2

Cellular Locus

Multi-pass membrane protein, Peroxisome membrane

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 83kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=225

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBJ2

AA Sequence

TARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAGEVVASRLNFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcalumenin (SRL) (NM_001098814) Human Recombinant Protein
TP314041 20 µg

Sarcalumenin (SRL) (NM_001098814) Human Recombinant Protein

Sign In for Pricing
View Details
CDC123 (Cell Division Cycle Protein 123 Homolog, Protein D123, HT-1080, PZ32, C10orf7, D123, FLJ13863) (HRP)
MBS6373382-01 0.1 mL

CDC123 (Cell Division Cycle Protein 123 Homolog, Protein D123, HT-1080, PZ32, C10orf7, D123, FLJ13863) (HRP)

Sign In for Pricing
View Details
CDC123 (Cell Division Cycle Protein 123 Homolog, Protein D123, HT-1080, PZ32, C10orf7, D123, FLJ13863) (HRP)
MBS6373382-02 5x 0.1 mL

CDC123 (Cell Division Cycle Protein 123 Homolog, Protein D123, HT-1080, PZ32, C10orf7, D123, FLJ13863) (HRP)

Sign In for Pricing
View Details
BODIPY FL Verapamil hydrochloride
T85883-01 10 mg

BODIPY FL Verapamil hydrochloride

Sign In for Pricing
View Details
BODIPY FL Verapamil hydrochloride
T85883-02 50 mg

BODIPY FL Verapamil hydrochloride

Sign In for Pricing
View Details
PS2 monoclonal antibody
MB66217-01 50 µL

PS2 monoclonal antibody

Sign In for Pricing
View Details