Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAZN Rabbit pAb (APR22613N)

Product Specifications

Background

This gene encodes a protein that plays a role in desmosome assembly, cell adhesion, cytoskeletal organization, and epidermal differentiation. This protein co-localizes with desmoplakin and the cytolinker protein periplakin. In general, this protein localizes to the nucleus, desmosomes, cell membrane, and cortical actin-based structures. Some isoforms of this protein also associate with microtubules. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity has not been verified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KAZN Rabbit pAb (APR22613N) .

Synonyms

KAZN; KAZ; kazrin

Gene ID

23254

UniProt

Q674X7

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/46kDa/86kDa Observed MW: 86kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23254

Uniprot URL

https://www.uniprot.org/uniprot/Q674X7

AA Sequence

YQVNFSREALQERRARCETQNIDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLVLEPTFNAEAMATALGIPSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTPPGRASSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDYGSLQNEDCGDDDPQSRLEQCRLEGYNSLEVTNV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Acvr1 activation kit by CRISPRa
GA200052 1 Kit

Mouse Acvr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Anti-Human CD107b-UNLB
9840-01 0.1 mg

Mouse Anti-Human CD107b-UNLB

Sign In for Pricing
View Details
Anti-Interferon alpha 2/IFNA2 Antibody (8I632)
MF-0078382-01 20 µL

Anti-Interferon alpha 2/IFNA2 Antibody (8I632)

Sign In for Pricing
View Details
Anti-Interferon alpha 2/IFNA2 Antibody (8I632)
MF-0078382-02 100 µL

Anti-Interferon alpha 2/IFNA2 Antibody (8I632)

Sign In for Pricing
View Details
Niobium Carbide (NbC) Powder
NMP-1080 100 g

Niobium Carbide (NbC) Powder

Sign In for Pricing
View Details
AMPK alpha-1 Monoclonal Antibody, FITC Conjugated
bsm-33338M-FITC-01 20 µL

AMPK alpha-1 Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details