Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G16 Rabbit pAb (APR22603N)

Product Specifications

Background

Exhibits both phospholipase A1/2 and acyltransferase activities. Shows phospholipase A1 (PLA1 and A2 (PLA2 activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids. For most substrates, PLA1 activity is much higher than PLA2 activity. Shows O-acyltransferase activity, catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid. Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE, forming N-acylphosphatidylethanolamine (NAPE, which serves as precursor for N-acylethanolamines (NAEs. Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity. Required for complete organelle rupture and degradation that occur during eye lens terminal differentiation, when fiber cells that compose the lens degrade all membrane-bound organelles in order to provide lens with transparency to allow the passage of light. Organelle membrane degradation is probably catalyzed by the phospholipase activity (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PLA2G16 Rabbit pAb (APR22597N8) .

Synonyms

PLA2G16; AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3

Gene ID

11145

UniProt

P53816

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11145

Uniprot URL

https://www.uniprot.org/uniprot/P53816

AA Sequence

VAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SLC16A13 Pre-designed siRNA Set A
SI014879A 1 Each

Human SLC16A13 Pre-designed siRNA Set A

Ask
View Details
Lentiviral mouse Nup210 shRNA (UAS) - Lentiviral mouse Nup210 shRNA (UAS) plasmid
GTR15214135 1 Vial

Lentiviral mouse Nup210 shRNA (UAS) - Lentiviral mouse Nup210 shRNA (UAS) plasmid

Ask
View Details
Magic™ Membrane Protein Human TLCD4 (TLC domain containing 4) Expressed in vitro E.coli expression system, Full Length
MPX2652K Each

Magic™ Membrane Protein Human TLCD4 (TLC domain containing 4) Expressed in vitro E.coli expression system, Full Length

Ask
View Details