Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hepcidin Rabbit pAb (APR22597N)

Product Specifications

Background

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Hepcidin Rabbit pAb (APR22597N) .

Synonyms

HAMP; HEPC; HFE2B; LEAP1; PLTR; hepcidin

Gene ID

57817

UniProt

P81172

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa Observed MW: 10kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57817

Uniprot URL

https://www.uniprot.org/uniprot/P81172

AA Sequence

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FT-1518
BA8726-1 1 mg

FT-1518

Sign In for Pricing
View Details
ARMC8 Polyclonal Antibody, Biotin Conjugated
A58155-100 100 µL

ARMC8 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
SLS Electrode pH Glass Robust Tip BNC
PHE1058 1 Each

SLS Electrode pH Glass Robust Tip BNC

Sign In for Pricing
View Details
HSPBP1 Antibody
CSB-PA010845GA01HU 100 µL

HSPBP1 Antibody

Sign In for Pricing
View Details
CYP17A1 Polyclonal Antibody, Biotin Conjugated
A54701-050 50 µL

CYP17A1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CD45R (RA3-6B2) Alexa Fluor® 594
sc-19597 AF594 200 µg/mL

CD45R (RA3-6B2) Alexa Fluor® 594

Sign In for Pricing
View Details