Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERKL Rabbit pAb (APR22576N)

Product Specifications

Background

This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD) . Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CERKL Rabbit pAb (APR22576N) .

Synonyms

CERKL; RP26

Gene ID

375298

UniProt

Q49MI3

Cellular Locus

Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Nucleus, nucleolus, nucleolus, trans-Golgi network

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa, 24kDa, 42-62kDa Observed MW: 63kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=375298

Uniprot URL

https://www.uniprot.org/uniprot/Q49MI3

AA Sequence

LAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNSSDDVQERRAQGSPKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMIPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD4, CT (PSMD4, MCB1, 26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit RPN10, 26S proteasome regulatory subunit S5A, Antisecretory factor 1, Multiubiquitin chain-binding protein) (Biotin)
MBS6338284-01 0.2 mL

PSMD4, CT (PSMD4, MCB1, 26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit RPN10, 26S proteasome regulatory subunit S5A, Antisecretory factor 1, Multiubiquitin chain-binding protein) (Biotin)

Sign In for Pricing
View Details
PSMD4, CT (PSMD4, MCB1, 26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit RPN10, 26S proteasome regulatory subunit S5A, Antisecretory factor 1, Multiubiquitin chain-binding protein) (Biotin)
MBS6338284-02 5x 0.2 mL

PSMD4, CT (PSMD4, MCB1, 26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit RPN10, 26S proteasome regulatory subunit S5A, Antisecretory factor 1, Multiubiquitin chain-binding protein) (Biotin)

Sign In for Pricing
View Details
PLA2G3 Rabbit Polyclonal Antibody (Fluoro550)
orb3099531 100 µg

PLA2G3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Ribonuclease Z (rnz)
MBS1105917-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Ribonuclease Z (rnz)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Ribonuclease Z (rnz)
MBS1105917-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. Ribonuclease Z (rnz)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Ribonuclease Z (rnz)
MBS1105917-03 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Ribonuclease Z (rnz)

Sign In for Pricing
View Details