Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP43 Rabbit pAb (APR22575N)

Product Specifications

Background

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUP43 Rabbit pAb (APR22575N) .

Synonyms

NUP43; bA350J20.1; p42

Gene ID

348995

UniProt

Q8NFH3

Cellular Locus

Chromosome, Nucleus, centromere, kinetochore, nuclear pore complex

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=348995

Uniprot URL

https://www.uniprot.org/uniprot/Q8NFH3

AA Sequence

DGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal IP6K1 Antibody [Janelia Fluor 585]
NBP3-18438JF585 0.1 mL

Rabbit Polyclonal IP6K1 Antibody [Janelia Fluor 585]

Ask
View Details
SMARCB1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily B Member 1, BRG1-associated Factor 47, BAF47, Integrase Interactor 1 Protein, SNF5 Homolog, hSNF5, BAF47, INI1, SNF5L1) discontinued
S1014-59J 50 µg

SMARCB1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily B Member 1, BRG1-associated Factor 47, BAF47, Integrase Interactor 1 Protein, SNF5 Homolog, hSNF5, BAF47, INI1, SNF5L1) discontinued

Ask
View Details
Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) RRG7 Polyclonal Antibody
MBS7168270 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) RRG7 Polyclonal Antibody

Ask
View Details
EIF4E2 (EIF4E2, EIF4EL3, Eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E homologous protein, Eukaryotic translation initiation factor 4E-like 3, eIF4E-like protein 4E-LP, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3) (PE) discontinued
030938-PE 200 µL

EIF4E2 (EIF4E2, EIF4EL3, Eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E homologous protein, Eukaryotic translation initiation factor 4E-like 3, eIF4E-like protein 4E-LP, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3) (PE) discontinued

Ask
View Details
TFAM (Transcription Factor A, Mitochondrial, mtTFA, Mitochondrial Transcription Factor 1, MtTF1, Transcription Factor 6, TCF-6, Transcription Factor 6-like 2, TFAM, TCF6, TCF6L20)
324605-01 50 µg

TFAM (Transcription Factor A, Mitochondrial, mtTFA, Mitochondrial Transcription Factor 1, MtTF1, Transcription Factor 6, TCF-6, Transcription Factor 6-like 2, TFAM, TCF6, TCF6L20)

Ask
View Details
TFAM (Transcription Factor A, Mitochondrial, mtTFA, Mitochondrial Transcription Factor 1, MtTF1, Transcription Factor 6, TCF-6, Transcription Factor 6-like 2, TFAM, TCF6, TCF6L20)
324605-02 100 µg

TFAM (Transcription Factor A, Mitochondrial, mtTFA, Mitochondrial Transcription Factor 1, MtTF1, Transcription Factor 6, TCF-6, Transcription Factor 6-like 2, TFAM, TCF6, TCF6L20)

Ask
View Details