Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF3 Rabbit pAb (APR22564N)

Product Specifications

Background

This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EBF3 Rabbit pAb (APR22564N) .

Synonyms

EBF3; COE3; EBF-3; HADDS; O/E-2; OE-2

Gene ID

253738

UniProt

Q9H4W6

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 60kDa/64kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=253738

Uniprot URL

https://www.uniprot.org/uniprot/Q9H4W6

AA Sequence

AEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E/E031/NT/RFL-390x390-1 Marine & IMO Signs & Labels (Adhesive)
303789 1 Pack (1 Panel (s) x 1 Pack)

E/E031/NT/RFL-390x390-1 Marine & IMO Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Lentiviral mouse Ropn1l shRNA (UAS) - Lentiviral mouse Ropn1l shRNA (UAS, GFP) (100)
GTR15161241 1 Vial

Lentiviral mouse Ropn1l shRNA (UAS) - Lentiviral mouse Ropn1l shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Peripheral plasma membrane protein CASK (CASK) Elisa Kit
EK714928 96 Well

Human Peripheral plasma membrane protein CASK (CASK) Elisa Kit

Sign In for Pricing
View Details
ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1) (MaxLight 650)
MBS6225564-01 0.1 mL

ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1) (MaxLight 650)

Sign In for Pricing
View Details
ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1) (MaxLight 650)
MBS6225564-02 5x 0.1 mL

ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1) (MaxLight 650)

Sign In for Pricing
View Details
Wdr18 (NM_175450) Mouse Tagged Lenti ORF Clone
MR206868L3 10 µg

Wdr18 (NM_175450) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details