Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGCZ Rabbit pAb (APR22550N)

Product Specifications

Background

The zeta-sarcoglycan gene measures over 465 kb and localizes to 8p22. This protein is part of the sarcoglycan complex, a group of 6 proteins. The sarcoglycans are all N-glycosylated transmembrane proteins with a short intra-cellular domain, a single transmembrane region and a large extra-cellular domain containing a carboxyl-terminal cluster with several conserved cysteine residues. The sarcoglycan complex is part of the dystrophin-associated glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extra-cellular matrix.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SGCZ Rabbit pAb (APR22541N8) .

Synonyms

SGCZ; ZSG1

Gene ID

137868

UniProt

Q96LD1

Cellular Locus

Cell membrane, Cytoplasm, Single-pass type II membrane protein, cytoskeleton, sarcolemma

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/34kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=137868

Uniprot URL

https://www.uniprot.org/uniprot/Q96LD1

AA Sequence

NLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSNICLWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL4L1 siRNA Oligos set (Human)
15372171 3x 5 nmol

CCL4L1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)
TRV-0054342-01 10 µg

Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)

Sign In for Pricing
View Details
Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)
TRV-0054342-02 50 µg

Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)

Sign In for Pricing
View Details
Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)
TRV-0054342-03 100 µg

Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)

Sign In for Pricing
View Details
Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)
TRV-0054342-04 200 µg

Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)

Sign In for Pricing
View Details
Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)
TRV-0054342-05 500 µg

Recombinant Adenosine Monophosphate Deaminase 3 (AMPD3)

Sign In for Pricing
View Details