Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSTRIN Rabbit pAb (APR22528N)

Product Specifications

Background

Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOSTRIN Rabbit pAb (APR22528N) .

Synonyms

NOSTRIN; DaIP2; nostrin

Gene ID

115677

UniProt

Q8IVI9

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Nucleus, Peripheral membrane protein, cytoskeleton

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/54kDa/57kDa/64kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=115677

Uniprot URL

https://www.uniprot.org/uniprot/Q8IVI9

AA Sequence

NCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Replacement Cartridge for Label Printers
L9010-12GW 1 Each

Replacement Cartridge for Label Printers

Sign In for Pricing
View Details
RAB38 Goat Polyclonal Antibody
AB0242-100 400 µg

RAB38 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-,  20nm
GP-1801-20 1 mL

Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-, 20nm

Sign In for Pricing
View Details
Androstane Spin Label (ASL)
TRC-A637395-10MG 10 mg

Androstane Spin Label (ASL)

Sign In for Pricing
View Details
Thymidylate Synthase (TYMS) Sheep Polyclonal Antibody
TA397083S 25 µL

Thymidylate Synthase (TYMS) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
ACE2 Biotinylated Mouse Monoclonal Detection Antibody [Clone ID: OTI1G4] (Angiotensin Converting Enzyme 2)
TA700564 100 µL

ACE2 Biotinylated Mouse Monoclonal Detection Antibody [Clone ID: OTI1G4] (Angiotensin Converting Enzyme 2)

Sign In for Pricing
View Details