Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSTRIN Rabbit pAb (APR22528N)

Product Specifications

Background

Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOSTRIN Rabbit pAb (APR22528N) .

Synonyms

NOSTRIN; DaIP2; nostrin

Gene ID

115677

UniProt

Q8IVI9

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Nucleus, Peripheral membrane protein, cytoskeleton

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/54kDa/57kDa/64kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=115677

Uniprot URL

https://www.uniprot.org/uniprot/Q8IVI9

AA Sequence

NCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS632503 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
IL16 (NM_004513) Human Over-expression Lysate
LC401436 20 µg

IL16 (NM_004513) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702020 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
VEGFC Rabbit Polyclonal Antibody
TA385549 100 µL

VEGFC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LDHAL6B Rabbit Polyclonal Antibody
TA377981 100 µL

LDHAL6B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pan-Cadherin Recombinant Rabbit monoclonal Antibody [ST54-01]
ET1609-70-50UL 50 µL

Pan-Cadherin Recombinant Rabbit monoclonal Antibody [ST54-01]

Sign In for Pricing
View Details