Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bad Rabbit pAb (APR22519N)

Product Specifications

Background

The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Bad Rabbit pAb (APR22519N) .

Synonyms

BAD; BBC2; BCL2L8; Bad

Gene ID

572

UniProt

Q92934

Cellular Locus

Cytoplasm, Mitochondrion outer membrane

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=572

Uniprot URL

https://www.uniprot.org/uniprot/Q92934

AA Sequence

YGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HE6 Lentiviral Activation Particles (m2)
sc-433537-LAC-2 200 µL

HE6 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal HIV TAT specific factor 1 Antibody
NBP1-18912 100 µL

Rabbit Polyclonal HIV TAT specific factor 1 Antibody

Sign In for Pricing
View Details
HP1α polyclonal antibody
6860-25 25 µg

HP1α polyclonal antibody

Sign In for Pricing
View Details
ATP5MF-PTCD1 (NM_001198879) Human Tagged ORF Clone
RG231399 10 µg

ATP5MF-PTCD1 (NM_001198879) Human Tagged ORF Clone

Sign In for Pricing
View Details
PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (MaxLight 550)
MBS6331084-01 0.1 mL

PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (MaxLight 550)

Sign In for Pricing
View Details
PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (MaxLight 550)
MBS6331084-02 5x 0.1 mL

PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (MaxLight 550)

Sign In for Pricing
View Details