Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN1 Rabbit pAb (APR22488N)

Product Specifications

Background

The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTPN1 Rabbit pAb (APR22488N) .

Synonyms

PTPN1; PTP1B

Gene ID

5770

UniProt

P18031

Cellular Locus

Cytoplasmic side, Endoplasmic reticulum membrane, Peripheral membrane protein

Applications

WB (Mouse liver, A549, Mus musculus, Homo sapiens) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5770

Uniprot URL

https://www.uniprot.org/uniprot/P18031

AA Sequence

IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)
MBS1324825-01 0.02 mg (E-Coli)

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)

Ask
View Details
Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)
MBS1324825-02 0.1 mg (E-Coli)

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)

Ask
View Details
Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)
MBS1324825-03 0.02 mg (Yeast)

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)

Ask
View Details
Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)
MBS1324825-04 0.1 mg (Yeast)

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)

Ask
View Details
Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)
MBS1324825-05 0.02 mg (Baculovirus)

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)

Ask
View Details
Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)
MBS1324825-06 0.02 mg (Mammalian-Cell)

Recombinant Chlamydia muridarum Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB)

Ask
View Details