Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNPTAB Rabbit pAb (APR22483N)

Product Specifications

Background

This gene encodes two of three subunit types of the membrane-bound enzyme N-acetylglucosamine-1-phosphotransferase, a heterohexameric complex composed of two alpha, two beta, and two gamma subunits. The encoded protein is proteolytically cleaved at the Lys928-Asp929 bond to yield mature alpha and beta polypeptides while the gamma subunits are the product of a distinct gene (GeneID 84572) . In the Golgi apparatus, the heterohexameric complex catalyzes the first step in the synthesis of mannose 6-phosphate recognition markers on certain oligosaccharides of newly synthesized lysosomal enzymes. These recognition markers are essential for appropriate trafficking of lysosomal enzymes. Mutations in this gene have been associated with both mucolipidosis II and mucolipidosis IIIA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GNPTAB Rabbit pAb (APR22477N5) .

Synonyms

GNPTAB; GNPTA; ICD

Gene ID

79158

UniProt

Q3T906

Cellular Locus

Golgi apparatus membrane, Single-pass type I membrane protein, Single-pass type II membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/143kDa Observed MW: 144kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79158

Uniprot URL

https://www.uniprot.org/uniprot/Q3T906

AA Sequence

LEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTKKSEKQLECLLTHCIKVPMLVLDPALPANITLKDLPSLYPSFHSASDIFNVAKPKNPSTNVSVVVFDSTKDVEDAHSGLLKGNSRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKETNQLKTKLPENLSSKVKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)
MBS1213620-01 0.02 mg (E-Coli)

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)
MBS1213620-02 0.02 mg (Yeast)

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)
MBS1213620-03 0.1 mg (E-Coli)

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)
MBS1213620-04 0.1 mg (Yeast)

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)
MBS1213620-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)
MBS1213620-06 0.02 mg (Mammalian-Cell)

Recombinant Mycobacterium bovis Undecaprenyl pyrophosphate synthase (uppS)

Sign In for Pricing
View Details