Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAPD5 Rabbit pAb (APR22472N)

Product Specifications

Background

Terminal nucleotidyltransferase that catalyzes preferentially the transfert of ATP and GTP on RNA 3' poly (A tail creating a heterogeneous 3' poly (A tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation. Also functions as a catalytic subunit of a TRAMP-like complex which has a poly (A RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo (A tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Doesn't need a cofactor for polyadenylation activity (in vitro. Required for cytoplasmic polyadenylation of mRNAs involved in carbohydrate metabolism, including the glucose transporter SLC2A1/GLUT1. Plays a role in replication-dependent histone mRNA degradation, probably through terminal uridylation of mature histone mRNAs. May play a role in sister chromatid cohesion. Mediates 3' adenylation of the microRNA MIR21 followed by its 3'-to-5' trimming by the exoribonuclease PARN leading to degradation. Mediates 3' adenylation of H/ACA box snoRNAs (small nucleolar RNAs followed by its 3'-to-5' trimming by the exoribonuclease PARN which enhances snoRNA stability and maturation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PAPD5 Rabbit pAb (APR22472N) .

Synonyms

PAPD5; TRF4-2

Gene ID

64282

UniProt

Q8NDF8

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/51kDa/63kDa/64kDa/75kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64282

Uniprot URL

https://www.uniprot.org/uniprot/Q8NDF8

AA Sequence

YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQSSSSDVDSDAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43979111 3x 1.0 µg

SLC25A11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
DOCK2 (NM_004946) Human Tagged Lenti ORF Clone
RC211198L1 10 µg

DOCK2 (NM_004946) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BTNL2 Polyclonal Antibody
MBS8568838-01 0.1 mL

BTNL2 Polyclonal Antibody

Sign In for Pricing
View Details
BTNL2 Polyclonal Antibody
MBS8568838-02 0.1 mL (AF405L)

BTNL2 Polyclonal Antibody

Sign In for Pricing
View Details
BTNL2 Polyclonal Antibody
MBS8568838-03 0.1 mL (AF405S)

BTNL2 Polyclonal Antibody

Sign In for Pricing
View Details
BTNL2 Polyclonal Antibody
MBS8568838-04 0.1 mL (AF610)

BTNL2 Polyclonal Antibody

Sign In for Pricing
View Details