Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF9B Rabbit pAb (APR22429N)

Product Specifications

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAF9B Rabbit pAb (APR22422N6) .

Synonyms

TAF9B; DN-7; DN7; TAF9L; TAFII31L; TFIID-31

Gene ID

51616

UniProt

Q9HBM6

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51616

Uniprot URL

https://www.uniprot.org/uniprot/Q9HBM6

AA Sequence

ILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCO1 (B-1)
sc-365407 200 µg/mL

SCO1 (B-1)

Sign In for Pricing
View Details
PRKD2 Antibody
orb1337339 100 µg

PRKD2 Antibody

Sign In for Pricing
View Details
CBFB (CBFB, Core-binding factor subunit beta, CBF-beta, Polyomavirus enhancer-binding protein 2 beta subunit, PEA2-beta, PEBP2-beta, SL3-3 enhancer factor 1 subunit beta, SL3/AKV core-binding factor beta subunit)
327847-01 50 µg

CBFB (CBFB, Core-binding factor subunit beta, CBF-beta, Polyomavirus enhancer-binding protein 2 beta subunit, PEA2-beta, PEBP2-beta, SL3-3 enhancer factor 1 subunit beta, SL3/AKV core-binding factor beta subunit)

Sign In for Pricing
View Details
CBFB (CBFB, Core-binding factor subunit beta, CBF-beta, Polyomavirus enhancer-binding protein 2 beta subunit, PEA2-beta, PEBP2-beta, SL3-3 enhancer factor 1 subunit beta, SL3/AKV core-binding factor beta subunit)
327847-02 100 µg

CBFB (CBFB, Core-binding factor subunit beta, CBF-beta, Polyomavirus enhancer-binding protein 2 beta subunit, PEA2-beta, PEBP2-beta, SL3-3 enhancer factor 1 subunit beta, SL3/AKV core-binding factor beta subunit)

Sign In for Pricing
View Details
Ring Finger Protein 13 (RNF13, E3 Ubiquitin-protein Ligase RNF13, RZF)
132646 100 µg

Ring Finger Protein 13 (RNF13, E3 Ubiquitin-protein Ligase RNF13, RZF)

Sign In for Pricing
View Details
KMT5A Peptide - middle region
MBS3244974-01 0.1 mg

KMT5A Peptide - middle region

Sign In for Pricing
View Details