Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPG2 Rabbit pAb (APR22397N)

Product Specifications

Background

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs, which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COPG2 Rabbit pAb (APR22397N) .

Synonyms

COPG2; 2-COP; gamma-2-COP

Gene ID

26958

UniProt

Q9UBF2

Cellular Locus

COPI-coated vesicle membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus membrane, Peripheral membrane protein, cytosol

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 81kDa/97kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26958

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBF2

AA Sequence

LNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALADGVTMQVTVRSKERTPVDVILASVG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal Leptin R Antibody (55305) [DyLight 650]
FAB497W 0.5 mL

Rat Monoclonal Leptin R Antibody (55305) [DyLight 650]

Ask
View Details
Rabbit Polyclonal ASCC3 Antibody
NBP3-30564 100 µg

Rabbit Polyclonal ASCC3 Antibody

Ask
View Details
Keratin 33B (Keratin-33B, KRT33B, K33B, KRTHA3B, Keratin Type I Cuticular Ha3-II, HA3II, Ha-3II, Hair Keratin Type I Ha3-II, HHA3-II, HKA3B, KRTHA3A) (MaxLight 405)
MBS6190843-01 0.1 mL

Keratin 33B (Keratin-33B, KRT33B, K33B, KRTHA3B, Keratin Type I Cuticular Ha3-II, HA3II, Ha-3II, Hair Keratin Type I Ha3-II, HHA3-II, HKA3B, KRTHA3A) (MaxLight 405)

Ask
View Details
Keratin 33B (Keratin-33B, KRT33B, K33B, KRTHA3B, Keratin Type I Cuticular Ha3-II, HA3II, Ha-3II, Hair Keratin Type I Ha3-II, HHA3-II, HKA3B, KRTHA3A) (MaxLight 405)
MBS6190843-02 5x 0.1 mL

Keratin 33B (Keratin-33B, KRT33B, K33B, KRTHA3B, Keratin Type I Cuticular Ha3-II, HA3II, Ha-3II, Hair Keratin Type I Ha3-II, HHA3-II, HKA3B, KRTHA3A) (MaxLight 405)

Ask
View Details
40S ribosomal protein S13 (RPS13) Bovine ELISA Kit
B0835 96 Tests

40S ribosomal protein S13 (RPS13) Bovine ELISA Kit

Ask
View Details
CEACAM5 shRNA Plasmid (h)
sc-72070-SH 20 µg

CEACAM5 shRNA Plasmid (h)

Ask
View Details