Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM98A Rabbit pAb (APR22386N)

Product Specifications

Background

Positively stimulates PRMT1-induced protein arginine methylation. Involved in skeletal homeostasis (By similarity. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (By similarity. Promotes colorectal cancer cell malignancy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FAM98A Rabbit pAb (APR22378N7) .

Synonyms

FAM98A

Gene ID

25940

UniProt

Q8NCA5

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25940

Uniprot URL

https://www.uniprot.org/uniprot/Q8NCA5

AA Sequence

MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KB2, ID (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Threonine-protein Kinase 14B, STK14B)
031228 200 µL

RPS6KB2, ID (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Threonine-protein Kinase 14B, STK14B)

Sign In for Pricing
View Details
PHC3 Protein Vector (Mouse) (pPM-C-His)
PV215621 500 ng

PHC3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RAVER1 siRNA (Rat)
MBS8210391-01 15 nmol

RAVER1 siRNA (Rat)

Sign In for Pricing
View Details
RAVER1 siRNA (Rat)
MBS8210391-02 30 nmol

RAVER1 siRNA (Rat)

Sign In for Pricing
View Details
RAVER1 siRNA (Rat)
MBS8210391-03 5x 30 nmol

RAVER1 siRNA (Rat)

Sign In for Pricing
View Details
Rat Cystatin SN (Cys-SN) ELISA Kit
QY-E10732 96 Tests

Rat Cystatin SN (Cys-SN) ELISA Kit

Sign In for Pricing
View Details