Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DICER1 Rabbit pAb (APR22377N)

Product Specifications

Background

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DICER1 Rabbit pAb (APR22377N) .

Synonyms

DICER1; DCR1; Dicer; Dicer1e; HERNA; K12H4.8-LIKE; MNG1; RMSE2

Gene ID

23405

UniProt

Q9UPY3

Cellular Locus

Cytoplasm

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 92kDa/208kDa/218kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23405

Uniprot URL

https://www.uniprot.org/uniprot/Q9UPY3

AA Sequence

TFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF140 Human qPCR Primer Pair (NM_003440)
HP206959 200 Reactions

ZNF140 Human qPCR Primer Pair (NM_003440)

Sign In for Pricing
View Details
Mouse Monoclonal Smad9 Antibody (PCRP-SMAD9-2F4) [Janelia Fluor 635]
NBP3-14117JF635 0.1 mL

Mouse Monoclonal Smad9 Antibody (PCRP-SMAD9-2F4) [Janelia Fluor 635]

Sign In for Pricing
View Details
Alkalinity reagent kit (±100 tests)
HI3812 1 Each

Alkalinity reagent kit (±100 tests)

Sign In for Pricing
View Details
NDUFA1 Antibody, HRP conjugated
A30411-100UG 100 µg

NDUFA1 Antibody, HRP conjugated

Sign In for Pricing
View Details
SUSD3 Rabbit Polyclonal Antibody
TA355016 100 µg

SUSD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEF1A1 (N-term) Mouse Monoclonal Antibody [Clone ID: 900]
AM26149PU-N 100 µg

EEF1A1 (N-term) Mouse Monoclonal Antibody [Clone ID: 900]

Sign In for Pricing
View Details