Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DICER1 Rabbit pAb (APR22377N)

Product Specifications

Background

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DICER1 Rabbit pAb (APR22377N) .

Synonyms

DICER1; DCR1; Dicer; Dicer1e; HERNA; K12H4.8-LIKE; MNG1; RMSE2

Gene ID

23405

UniProt

Q9UPY3

Cellular Locus

Cytoplasm

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 92kDa/208kDa/218kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23405

Uniprot URL

https://www.uniprot.org/uniprot/Q9UPY3

AA Sequence

TFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B2 (NM_000196) Human Tagged Lenti ORF Clone
RC207796L4 10 µg

HSD11B2 (NM_000196) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fblim1 3'UTR Luciferase Stable Cell Line
TU106379 1.0 mL

Fblim1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ACSF2 Antibody - C-terminal region : Biotin (ARP60794_P050-Biotin)
ARP60794_P050-Biotin 100 µL

ACSF2 Antibody - C-terminal region : Biotin (ARP60794_P050-Biotin)

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni rplQ Protein (aa 1-117) (strain RM1221)
VAng-Ly2885-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni rplQ Protein (aa 1-117) (strain RM1221)

Sign In for Pricing
View Details
LOC118706 Human qPCR Primer Pair (XM_058336)
HP220809 200 Reactions

LOC118706 Human qPCR Primer Pair (XM_058336)

Sign In for Pricing
View Details
ABHD1, CT (ABHD1, LABH1, Abhydrolase domain-containing protein 1, Lung alpha/beta hydrolase 1) (Azide free) (HRP)
MBS6270544-01 0.2 mL

ABHD1, CT (ABHD1, LABH1, Abhydrolase domain-containing protein 1, Lung alpha/beta hydrolase 1) (Azide free) (HRP)

Sign In for Pricing
View Details