Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPLA2 Rabbit pAb (APR22370N)

Product Specifications

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LYPLA2 Rabbit pAb (APR22367N2) .

Synonyms

LYPLA2; APT-2; APT2; DJ886K2.4

Gene ID

11313

UniProt

O95372

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11313

Uniprot URL

https://www.uniprot.org/uniprot/O95372

AA Sequence

CWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olr1351 (NM_001000751) Rat Tagged Lenti ORF Clone
RR212624L4 10 µg

Olr1351 (NM_001000751) Rat Tagged Lenti ORF Clone

Ask
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB14 Polyclonal Antibody
MBS9004790 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB14 Polyclonal Antibody

Ask
View Details
GSTP1 Polyclonal Antibody, HRP Conjugated
bs-42396R-HRP 100 µL

GSTP1 Polyclonal Antibody, HRP Conjugated

Ask
View Details
Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) ) (BSA & Azide Free) (MaxLight 550)
168818-AF-ML550 100 µL

Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) ) (BSA & Azide Free) (MaxLight 550)

Ask
View Details
Aldh1b1 Mouse qPCR Template Standard (NM_028270)
MK203350 1 Kit

Aldh1b1 Mouse qPCR Template Standard (NM_028270)

Ask
View Details
Rabbit Polyclonal RFX1 Antibody [CoraFluor 1]
NBP1-52653CL1 0.1 mL

Rabbit Polyclonal RFX1 Antibody [CoraFluor 1]

Ask
View Details