Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APPBP2 Rabbit pAb (APR22358N)

Product Specifications

Background

The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. The encoded protein may be involved in regulating cell death. This gene has been found to be highly expressed in breast cancer. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality APPBP2 Rabbit pAb (APR22358N) .

Synonyms

APPBP2; APP-BP2; HS.84084; PAT1

Gene ID

10513

UniProt

Q92624

Cellular Locus

Cytoplasm, Membrane, Nucleus, Peripheral membrane protein, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa Observed MW: 67kDa,71kDa,80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10513

Uniprot URL

https://www.uniprot.org/uniprot/Q92624

AA Sequence

LEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (MaxLight 405)
MBS6312483-01 0.1 mL

KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (MaxLight 405)

Ask
View Details
KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (MaxLight 405)
MBS6312483-02 5x 0.1 mL

KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (MaxLight 405)

Ask
View Details
Dystrobrevin alpha (DTNA) (NM_001392) Human Tagged ORF Clone Lentiviral Particle
RC223692L4V 200 µL

Dystrobrevin alpha (DTNA) (NM_001392) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
HIGD2A (m) -PR
sc-145964-PR 10 µM - 20 µL

HIGD2A (m) -PR

Ask
View Details
HP1, alpha (HP1, HP1A, CBX5)
143194 100 µL

HP1, alpha (HP1, HP1A, CBX5)

Ask
View Details