Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED20 Rabbit pAb (APR22332N)

Product Specifications

Background

This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. A mutation in this gene has been associated with a novel infantile-onset neurodegenerative movement disorder. Alternatively spliced transcript variants have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MED20 Rabbit pAb (APR22332N) .

Synonyms

MED20; PRO0213; TRFP; SRB2

Gene ID

9477

UniProt

Q9H944

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/23kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9477

Uniprot URL

https://www.uniprot.org/uniprot/Q9H944

AA Sequence

MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

K-Ras(G12C) inhibitor 12
B4876-10 10 mg

K-Ras(G12C) inhibitor 12

Sign In for Pricing
View Details
Cx3cr1 3'UTR Lenti-reporter-Luc Vector
17158086 1.0 µg

Cx3cr1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MPL Antibody
MBS7117675-01 0.05 mg

MPL Antibody

Sign In for Pricing
View Details
MPL Antibody
MBS7117675-02 0.1 mg

MPL Antibody

Sign In for Pricing
View Details
MPL Antibody
MBS7117675-03 5x 0.1 mg

MPL Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Pit1 Antibody
NBP2-85476-0.1mL 0.1 mL

Rabbit Polyclonal Pit1 Antibody

Sign In for Pricing
View Details