Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED20 Rabbit pAb (APR22332N)

Product Specifications

Background

This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. A mutation in this gene has been associated with a novel infantile-onset neurodegenerative movement disorder. Alternatively spliced transcript variants have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MED20 Rabbit pAb (APR22332N) .

Synonyms

MED20; PRO0213; TRFP; SRB2

Gene ID

9477

UniProt

Q9H944

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/23kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9477

Uniprot URL

https://www.uniprot.org/uniprot/Q9H944

AA Sequence

MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp2d3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6844208 1.0 µg DNA

Cyp2d3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Cytokeratin, pan (KRT) (Biotin)
172085-Biotin 100 µL

Cytokeratin, pan (KRT) (Biotin)

Sign In for Pricing
View Details
XIC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
50518061 1.0 µg DNA

XIC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRNAS17 sgRNA CRISPR Lentivector (Human) (Target 2)
K2523303 1.0 µg DNA

TRNAS17 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-MYD88 Polyclonal Antibody
TMAB-01192-01 50 μL

Anti-MYD88 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MYD88 Polyclonal Antibody
TMAB-01192-02 100 µL

Anti-MYD88 Polyclonal Antibody

Sign In for Pricing
View Details