Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHL5 Rabbit pAb (APR22331N)

Product Specifications

Background

The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM) . It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FHL5 Rabbit pAb (APR22331N) .

Synonyms

FHL5; 1700027G07Rik; ACT; FHL-5; dJ393D12.2

Gene ID

9457

UniProt

Q5TD97

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa Observed MW: 33KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9457

Uniprot URL

https://www.uniprot.org/uniprot/Q5TD97

AA Sequence

MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP13 Mouse Monoclonal Antibody [Clone ID: OTI2A6]
TA506803 100 µL

MMP13 Mouse Monoclonal Antibody [Clone ID: OTI2A6]

Sign In for Pricing
View Details
RRM1 Antibody
orb1332522 100 µg

RRM1 Antibody

Sign In for Pricing
View Details
Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2029468-01 0.01 mg

Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Sign In for Pricing
View Details
Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2029468-02 0.05 mg

Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Sign In for Pricing
View Details
Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2029468-03 0.1 mg

Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Sign In for Pricing
View Details
Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2029468-04 0.2 mg

Recombinant Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Sign In for Pricing
View Details