Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST2 Rabbit pAb (APR22330N)

Product Specifications

Background

This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHST2 Rabbit pAb (APR22330N) .

Synonyms

CHST2; C6ST; GST-2; GST2; Gn6ST-1; HEL-S-75; glcNAc6ST-1

Gene ID

9435

UniProt

Q9Y4C5

Cellular Locus

Golgi apparatus, Single-pass type II membrane protein, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa/57kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9435

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y4C5

AA Sequence

FQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse hepatitis B virus e antibody, HBeAb ELISA Kit
YLA0686MO-01 48 Tests

Mouse hepatitis B virus e antibody, HBeAb ELISA Kit

Sign In for Pricing
View Details
Mouse hepatitis B virus e antibody, HBeAb ELISA Kit
YLA0686MO-02 96 Tests

Mouse hepatitis B virus e antibody, HBeAb ELISA Kit

Sign In for Pricing
View Details
Anti-Kallikrein 11/KLK11 Antibody Picoband® (Dylight488 Conjugate)
PA1631-Dylight488 100 µg

Anti-Kallikrein 11/KLK11 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
RPL15P20 CRISPRa sgRNA lentivector (set of three targets)(Human)
40860121 3x 1.0µg DNA

RPL15P20 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
1-Cyclopentyl-5-methoxy-2-methyl-1H-indole-3-carboxylic acid
GXB24535-01 50 mg

1-Cyclopentyl-5-methoxy-2-methyl-1H-indole-3-carboxylic acid

Sign In for Pricing
View Details
1-Cyclopentyl-5-methoxy-2-methyl-1H-indole-3-carboxylic acid
GXB24535-02 0.5 g

1-Cyclopentyl-5-methoxy-2-methyl-1H-indole-3-carboxylic acid

Sign In for Pricing
View Details