Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST2 Rabbit pAb (APR22330N)

Product Specifications

Background

This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHST2 Rabbit pAb (APR22330N) .

Synonyms

CHST2; C6ST; GST-2; GST2; Gn6ST-1; HEL-S-75; glcNAc6ST-1

Gene ID

9435

UniProt

Q9Y4C5

Cellular Locus

Golgi apparatus, Single-pass type II membrane protein, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa/57kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9435

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y4C5

AA Sequence

FQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Brain-gut peptides (BGP) ELISA Kit
NSL0825Po 96 Tests

Porcine Brain-gut peptides (BGP) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse 4933417A18Rik shRNA (UAS) - Lentiviral mouse 4933417A18Rik shRNA (UAS, RFP) plasmid
GTR15177301 1 Vial

Lentiviral mouse 4933417A18Rik shRNA (UAS) - Lentiviral mouse 4933417A18Rik shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
XRCC1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2536913 100 µL

XRCC1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Phospho-PTK2 (Y925) Antibody
A40111-100UG 100 µg

Phospho-PTK2 (Y925) Antibody

Sign In for Pricing
View Details
OR10Z1 3'UTR Lenti-reporter-Luc Vector
34923081 1.0 µg

OR10Z1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Phospho-PAK1 (Thr212) Rabbit Polyclonal Antibody (BF594)
orb2410314 100 µL

Phospho-PAK1 (Thr212) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details