Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF134 Rabbit pAb (APR22313N)

Product Specifications

Background

May be involved in transcriptional regulation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF134 Rabbit pAb (APR22313N) .

Synonyms

ZNF134; pHZ-15

Gene ID

7693

UniProt

P52741

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/48kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7693

Uniprot URL

https://www.uniprot.org/uniprot/P52741

AA Sequence

YSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine pregnancy associated plasma Protein A, PAPP-A GENLISA ELISA
KLB2096 1x 96 Well

Bovine pregnancy associated plasma Protein A, PAPP-A GENLISA ELISA

Sign In for Pricing
View Details
TANK Antibody
24438 100 µL

TANK Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1160395-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1160395-02 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1160395-03 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1160395-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 2 Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Sign In for Pricing
View Details