Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORD Rabbit pAb (APR22300N)

Product Specifications

Background

Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]) . The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD (+) cofactor.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SORD Rabbit pAb (APR22300N) .

Synonyms

SORD; HEL-S-95n; SORD1

Gene ID

6652

UniProt

Q00796

Cellular Locus

Cell projection, Mitochondrion membrane, Peripheral membrane protein, cilium, flagellum

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/38kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6652

Uniprot URL

https://www.uniprot.org/uniprot/Q00796

AA Sequence

MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit
MBS283275-01 48 Tests

Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit

Sign In for Pricing
View Details
Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit
MBS283275-02 96 Tests

Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit

Sign In for Pricing
View Details
Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit
MBS283275-03 5x 96 Tests

Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit

Sign In for Pricing
View Details
Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit
MBS283275-04 10x 96 Tests

Human Potassium voltage-gated channel subfamily E member 1 (KCNE1) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit
RDR-PPARgC1a-Hu-48Tests 48 Tests

Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit

Sign In for Pricing
View Details
H2AB1 Antibody
MBS9520175-01 0.04 mL

H2AB1 Antibody

Sign In for Pricing
View Details