Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P70 S6 Kinase 1 Rabbit pAb (APR22292N)

Product Specifications

Background

This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality p70 S6 Kinase 1 Rabbit pAb (APR22292N) .

Synonyms

PS6K; S6K; S6K-beta-1; S6K1; STK14A; p70 S6KA; p70 (S6K) -alpha; p70-S6K; p70-alpha; P70 S6K; RPS6KB1; p70S6KA

Gene ID

6198

UniProt

P23443

Cellular Locus

Cell junction, Cytoplasm, Mitochondrion outer membrane, Mitochondrion, Nucleus, synapse, synaptosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/52kDa/56kDa/59kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6198

Uniprot URL

https://www.uniprot.org/uniprot/P23443

AA Sequence

LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmd11 (NM_178616) Mouse Tagged Lenti ORF Clone
MR206719L2 10 µg

Psmd11 (NM_178616) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NIH-3T3
ABC-TC0828 1 Vial

NIH-3T3

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Protein-tyrosine sulfotransferase (TPST), partial
MBS7079267 Inquire

Recombinant Arabidopsis thaliana Protein-tyrosine sulfotransferase (TPST), partial

Sign In for Pricing
View Details
High Speed Centrifuge
LX129HSC 1 Unit

High Speed Centrifuge

Sign In for Pricing
View Details
RGD1306917 3'UTR Luciferase Stable Cell Line
TU217674 1.0 mL

RGD1306917 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Sporamin A Antibody (FITC)
abx318898-01 20 µg

Sporamin A Antibody (FITC)

Sign In for Pricing
View Details