Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (APR22279N)

Product Specifications

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (APR22279N) .

Synonyms

PPP2R5D; B56D; MRD35; B56delta

Gene ID

5528

UniProt

Q14738

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa/66kDa/69kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5528

Uniprot URL

https://www.uniprot.org/uniprot/Q14738

AA Sequence

LYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF640R conjugate, 0.1mg/mL
BNC402746-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF647 conjugate, 0.1mg/mL
BNC470955-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details