Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLC gamma 1 (PLCG1) Rabbit pAb (APR22276N)

Product Specifications

Background

The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor) -activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PLC gamma 1 (PLCG1) Rabbit pAb (APR22276N) .

Synonyms

PLCG1; NCKAP3; PLC-II; PLC1; PLC148; PLCgamma1

Gene ID

5335

UniProt

P19174

Cellular Locus

Cell projection, lamellipodium, ruffle

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 148kDa Observed MW: 149kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5335

Uniprot URL

https://www.uniprot.org/uniprot/P19174

AA Sequence

LASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trihexyltetradecylphosphonium hexafluorophosphate
IN-0012-TG-BULK 1 Each

Trihexyltetradecylphosphonium hexafluorophosphate

Sign In for Pricing
View Details
Armc7 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6554104 1.0 µg DNA

Armc7 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Horse vitamin B12, VB12 ELISA KIT
EA0030HO-01 96 Well

Horse vitamin B12, VB12 ELISA KIT

Sign In for Pricing
View Details
Horse vitamin B12, VB12 ELISA KIT
EA0030HO-02 5x 96 Tests

Horse vitamin B12, VB12 ELISA KIT

Sign In for Pricing
View Details
Horse vitamin B12, VB12 ELISA KIT
EA0030HO-03 10x 96 Tests

Horse vitamin B12, VB12 ELISA KIT

Sign In for Pricing
View Details
SPAG5 siRNA Oligos set (Human)
45184171 3x 5 nmol

SPAG5 siRNA Oligos set (Human)

Sign In for Pricing
View Details