Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINI1 Rabbit pAb (APR22275N)

Product Specifications

Background

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SERPINI1 Rabbit pAb (APR22275N) .

Synonyms

SERPINI1; PI12

Gene ID

5274

UniProt

Q99574

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa Observed MW: 46kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5274

Uniprot URL

https://www.uniprot.org/uniprot/Q99574

AA Sequence

INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIAP25 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV741359 1.0 µg DNA

PPIAP25 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GRP94 Polyclonal Antibody, Cy5 Conjugated
bs-0194R-Cy5 100 µL

GRP94 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Smad 1,2,3,5 (Mothers Against Decapentaplegic Homolog, MAD Homolog, Mothers Against DPP Homolog, JV4-1, Mad-Related Protein, SMAD Family Member, SMAD 1, SMAD 2, SMAD 3, SMAD 5, Smad1, Smad2, Smad3, Smad5, hSMAD1, hSMAD2, hSMAD3, hSMAD5, Transforming Growth Factor-beta-signaling Protein 1, BSP-1, SMAD1, SMAD2, SMAD3, SMAD5, BSP1, MADH1, MADR1, JV18-1, hMAD-2, Mad3, hMAD-3, hMAD-2, MADH2, MADH3, MADH5, JV5-1) discontinued
215460 100 µg

Smad 1,2,3,5 (Mothers Against Decapentaplegic Homolog, MAD Homolog, Mothers Against DPP Homolog, JV4-1, Mad-Related Protein, SMAD Family Member, SMAD 1, SMAD 2, SMAD 3, SMAD 5, Smad1, Smad2, Smad3, Smad5, hSMAD1, hSMAD2, hSMAD3, hSMAD5, Transforming Growth Factor-beta-signaling Protein 1, BSP-1, SMAD1, SMAD2, SMAD3, SMAD5, BSP1, MADH1, MADR1, JV18-1, hMAD-2, Mad3, hMAD-3, hMAD-2, MADH2, MADH3, MADH5, JV5-1) discontinued

Sign In for Pricing
View Details
GSTM4 (Glutathione S-transferase Mu 4 Isoform 1, GST Class-mu 4, GST-Mu2, GSTM4-4, MGC131945, MGC9247) (Biotin)
127602-Biotin 100 µL

GSTM4 (Glutathione S-transferase Mu 4 Isoform 1, GST Class-mu 4, GST-Mu2, GSTM4-4, MGC131945, MGC9247) (Biotin)

Sign In for Pricing
View Details
MLIP/C6orf142 Polyclonal Antibody FITC Conjugated
orb1540628 100 µL

MLIP/C6orf142 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
PCMV-Gja1-3xFLAG-Neo Plasmid
PVT69343 2 µg

PCMV-Gja1-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details