Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC2 Rabbit pAb (APR22268N)

Product Specifications

Background

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. This protein forms a core complex with ORC3, -4, and -5. It also interacts with CDC45 and MCM10, which are proteins known to be important for the initiation of DNA replication. This protein has been demonstrated to specifically associate with the origin of replication of Epstein-Barr virus in human cells, and is thought to be required for DNA replication from viral origin of replication. Alternatively spliced transcript variants have been found, one of which is a nonsense-mediated mRNA decay candidate.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ORC2 Rabbit pAb (APR22268N) .

Synonyms

ORC2; ORC2L

Gene ID

4999

UniProt

Q13416

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4999

Uniprot URL

https://www.uniprot.org/uniprot/Q13416

AA Sequence

TSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX5 antibody - C-terminal region
MBS3215901-01 0.1 mL

ARMCX5 antibody - C-terminal region

Sign In for Pricing
View Details
ARMCX5 antibody - C-terminal region
MBS3215901-02 5x 0.1 mL

ARMCX5 antibody - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal E6AP/UBE3A Antibody [Alexa Fluor 594]
NBP2-98953AF594 0.1 mL

Rabbit Polyclonal E6AP/UBE3A Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
hsa-miR-1178-3p miRNA Mimic
MCH01055 2x 2.5 nmol

hsa-miR-1178-3p miRNA Mimic

Sign In for Pricing
View Details
ZNF772 (NM_001024596) Human Tagged Lenti ORF Clone
RC218927L4 10 µg

ZNF772 (NM_001024596) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BMP4 Protein, Mouse, Recombinant (rFc Tag)
E45M53427M3-10 10 µg

BMP4 Protein, Mouse, Recombinant (rFc Tag)

Sign In for Pricing
View Details