Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA10 Rabbit pAb (APR22251N)

Product Specifications

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNA10 Rabbit pAb (APR22251N) .

Synonyms

KCNA10; Kcn1; Kv1.8

Gene ID

3744

UniProt

Q16322

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 62kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3744

Uniprot URL

https://www.uniprot.org/uniprot/Q16322

AA Sequence

MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHETAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQFFDSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SAT1 Antibody
NB110-41622SS 0.025 mL

Rabbit Polyclonal SAT1 Antibody

Sign In for Pricing
View Details
TDRD12 sgRNA CRISPR Lentivector set (Human)
K2355201 3x 1.0 µg

TDRD12 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lphn3 3'UTR Luciferase Stable Cell Line
TU212499 1.0 mL

Lphn3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS504832 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
TMCO1 Protein Vector (Human) (pPM-C-HA)
PV042379 500 ng

TMCO1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PRRX1, CT (PRRX1, PMX1, Paired mesoderm homeobox protein 1, Homeobox protein PHOX1, Paired-related homeobox protein 1) (AP) discontinued
040515-AP 200 µL

PRRX1, CT (PRRX1, PMX1, Paired mesoderm homeobox protein 1, Homeobox protein PHOX1, Paired-related homeobox protein 1) (AP) discontinued

Sign In for Pricing
View Details