Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA10 Rabbit pAb (APR22251N)

Product Specifications

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNA10 Rabbit pAb (APR22251N) .

Synonyms

KCNA10; Kcn1; Kv1.8

Gene ID

3744

UniProt

Q16322

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 62kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3744

Uniprot URL

https://www.uniprot.org/uniprot/Q16322

AA Sequence

MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHETAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQFFDSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (MT310) : m-IgGκ BP-HRP Bundle
sc-520696 1 Kit

CD4 (MT310) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
TMEM39B Double Nickase Plasmid (m2)
sc-432985-NIC-2 20 µg

TMEM39B Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Mouse Monoclonal Latent TGF-beta bp1 Antibody (MM0447-5L38) [HRP]
NBP2-11783H 0.1 mL

Mouse Monoclonal Latent TGF-beta bp1 Antibody (MM0447-5L38) [HRP]

Sign In for Pricing
View Details
GLIPR1L2 HDR Plasmid (m)
sc-426616-HDR 20 µg

GLIPR1L2 HDR Plasmid (m)

Sign In for Pricing
View Details
2- (Chloromethyl) -5-thien-2-yl-1,3,4-oxadiazole
CEB37487-01 0.5 g

2- (Chloromethyl) -5-thien-2-yl-1,3,4-oxadiazole

Sign In for Pricing
View Details
2- (Chloromethyl) -5-thien-2-yl-1,3,4-oxadiazole
CEB37487-02 5 g

2- (Chloromethyl) -5-thien-2-yl-1,3,4-oxadiazole

Sign In for Pricing
View Details