Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNGT1 Rabbit pAb (APR22244N)

Product Specifications

Background

This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GNGT1 Rabbit pAb (APR22238N5) .

Synonyms

GNGT1; GNG1

Gene ID

2792

UniProt

P63211

Cellular Locus

Cell membrane, Cytoplasmic side, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa Observed MW: 10kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2792

Uniprot URL

https://www.uniprot.org/uniprot/P63211

AA Sequence

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpk3 (NM_054085) Mouse Tagged ORF Clone
MR218500 10 µg

Alpk3 (NM_054085) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Pan CEA (TET2)
sc-59875 200 µg/mL

Pan CEA (TET2)

Sign In for Pricing
View Details
Human Antithrombin III Deficient Citrate Plasma
B2014931 1 mL

Human Antithrombin III Deficient Citrate Plasma

Sign In for Pricing
View Details
Rat tyrosine kinase with immunoglobulin-like and EGF-like domains 2, Tie-2 ELISA Kit
MBS161013-01 48 Well

Rat tyrosine kinase with immunoglobulin-like and EGF-like domains 2, Tie-2 ELISA Kit

Sign In for Pricing
View Details
Rat tyrosine kinase with immunoglobulin-like and EGF-like domains 2, Tie-2 ELISA Kit
MBS161013-02 96 Well

Rat tyrosine kinase with immunoglobulin-like and EGF-like domains 2, Tie-2 ELISA Kit

Sign In for Pricing
View Details
Rat tyrosine kinase with immunoglobulin-like and EGF-like domains 2, Tie-2 ELISA Kit
MBS161013-03 5x 96 Well

Rat tyrosine kinase with immunoglobulin-like and EGF-like domains 2, Tie-2 ELISA Kit

Sign In for Pricing
View Details