Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNTB Rabbit pAb (APR22240N)

Product Specifications

Background

Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FNTB Rabbit pAb (APR22238N1) .

Synonyms

FNTB; FPTB; farnesyltransferase; CAAX box; beta

Gene ID

2342

UniProt

P49356

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa/48kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2342

Uniprot URL

https://www.uniprot.org/uniprot/P49356

AA Sequence

MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)
MBS2137165-01 0.1 mL

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)
MBS2137165-02 0.2 mL

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)
MBS2137165-03 0.5 mL

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)
MBS2137165-04 1 mL

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)
MBS2137165-05 5 mL

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)
MBS2137165-06 5x 5 mL

Cy3 Linked Polyclonal Antibody to Stromal Antigen 2 (STAG2)

Sign In for Pricing
View Details