Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNTB Rabbit pAb (APR22240N)

Product Specifications

Background

Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FNTB Rabbit pAb (APR22238N1) .

Synonyms

FNTB; FPTB; farnesyltransferase; CAAX box; beta

Gene ID

2342

UniProt

P49356

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa/48kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2342

Uniprot URL

https://www.uniprot.org/uniprot/P49356

AA Sequence

MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD203a (SWC9) discontinued
397000 100 µg

CD203a (SWC9) discontinued

Sign In for Pricing
View Details
Recombinant Hepatitis C HCV NS3 Genotype-1b Protein, GST, E.coli-500ug
QP14027-500ug 500ug

Recombinant Hepatitis C HCV NS3 Genotype-1b Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
RAD9 Polyclonal Antibody, PE-Cy7 Conjugated
bs-4179R-PE-Cy7 100 µL

RAD9 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Human OR52B4 Protein, His (Fc)-Avi-tagged
OR52B4-3756H 50 µg

Recombinant Human OR52B4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Monoclonal C16orf72 Antibody (OTI2D1) [Alexa Fluor 700]
NBP2-71842AF700 0.1 mL

Mouse Monoclonal C16orf72 Antibody (OTI2D1) [Alexa Fluor 700]

Sign In for Pricing
View Details
Gliomedin Antibody
DF13626-01 100 µL

Gliomedin Antibody

Sign In for Pricing
View Details