Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETS1 Rabbit pAb (APR22234N)

Product Specifications

Background

This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ETS1 Rabbit pAb (APR22227N6) .

Synonyms

ETS-1; EWSR2; c-ets-1; p54; ETS1

Gene ID

2113

UniProt

P14921

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/30kDa/40kDa/50kDa/55kDa Observed MW: 50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2113

Uniprot URL

https://www.uniprot.org/uniprot/P14921

AA Sequence

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD69 Antibody
KC-32153-01 50 μL

CD69 Antibody

Sign In for Pricing
View Details
CD69 Antibody
KC-32153-02 100 µL

CD69 Antibody

Sign In for Pricing
View Details
CD69 Antibody
KC-32153-03 1 mL

CD69 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS651164 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
PNPO Mouse Monoclonal Antibody [Clone ID: AT2C7]
AM39001PU-S 50 µL

PNPO Mouse Monoclonal Antibody [Clone ID: AT2C7]

Sign In for Pricing
View Details
Human Fbx15 (FBXO15) activation kit by CRISPRa
GA116393 1 Kit

Human Fbx15 (FBXO15) activation kit by CRISPRa

Sign In for Pricing
View Details