Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETS1 Rabbit pAb (APR22234N)

Product Specifications

Background

This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ETS1 Rabbit pAb (APR22227N6) .

Synonyms

ETS-1; EWSR2; c-ets-1; p54; ETS1

Gene ID

2113

UniProt

P14921

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/30kDa/40kDa/50kDa/55kDa Observed MW: 50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2113

Uniprot URL

https://www.uniprot.org/uniprot/P14921

AA Sequence

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®770 Monoclonal Mouse Anti-GFP IgG, 1mg/mL
#20220 1x 100 µL

CF®770 Monoclonal Mouse Anti-GFP IgG, 1mg/mL

Sign In for Pricing
View Details
Human PLEKHM3 activation kit by CRISPRa
GA118017 1 Kit

Human PLEKHM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Zinpyr-1
TRC-Z440000-1MG 1 mg

Zinpyr-1

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-500 1x 500 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C3ar1 Mouse Gene Knockout Kit (CRISPR)
KN302378BN 1 Kit

C3ar1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Acridine Orange Fluorescent Staining Solution
6130 0.5 mL

Acridine Orange Fluorescent Staining Solution

Sign In for Pricing
View Details