Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENSA Rabbit pAb (APR22233N)

Product Specifications

Background

The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ENSA Rabbit pAb (APR22233N) .

Synonyms

ENSA; ARPP-19e

Gene ID

2029

UniProt

O43768

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/12kDa/13kDa/14kDa/15kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2029

Uniprot URL

https://www.uniprot.org/uniprot/O43768

AA Sequence

MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein-AM/PI Double Staining Kit
E37F031-1000 Tests 1000 Tests

Calcein-AM/PI Double Staining Kit

Sign In for Pricing
View Details
Glucose 6 phosphatase 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-13386R-BF647-01 20 µL

Glucose 6 phosphatase 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Glucose 6 phosphatase 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-13386R-BF647-02 100 µL

Glucose 6 phosphatase 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Human Transferrin, Biotin Conjugated
bs-2052P-Biotin 10 mg

Human Transferrin, Biotin Conjugated

Sign In for Pricing
View Details
MMP9 Polyclonal Antibody
MBS2564442-01 0.02 mL

MMP9 Polyclonal Antibody

Sign In for Pricing
View Details
MMP9 Polyclonal Antibody
MBS2564442-02 0.06 mL

MMP9 Polyclonal Antibody

Sign In for Pricing
View Details