Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABR Rabbit pAb (APR22201N)

Product Specifications

Background

This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABR Rabbit pAb (APR22196N5) .

Synonyms

ABR; MDB

Gene ID

29

UniProt

Q12979

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/92kDa/93kDa/97kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29

Uniprot URL

https://www.uniprot.org/uniprot/Q12979

AA Sequence

DPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Met, Phosphorylated (Tyr1234/1235)
M3007-21 100 µL

Met, Phosphorylated (Tyr1234/1235)

Sign In for Pricing
View Details
Rabgap1 (NM_001107841) Rat Tagged Lenti ORF Clone
RR204253L4 10 µg

Rabgap1 (NM_001107841) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GRIN2D CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22675124 3x 1.0µg DNA

GRIN2D CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Exosome component 5 Antibody (V80P1C10-C) [Alexa Fluor 350]
NBP2-50173AF350 0.1 mL

Mouse Monoclonal Exosome component 5 Antibody (V80P1C10-C) [Alexa Fluor 350]

Sign In for Pricing
View Details
RFC2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38852126 3x 1.0µg DNA

RFC2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Olr757 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV637063 1.0 µg DNA

Olr757 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details