Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABR Rabbit pAb (APR22201N)

Product Specifications

Background

This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABR Rabbit pAb (APR22196N5) .

Synonyms

ABR; MDB

Gene ID

29

UniProt

Q12979

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/92kDa/93kDa/97kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29

Uniprot URL

https://www.uniprot.org/uniprot/Q12979

AA Sequence

DPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IER5 Antibody [DyLight 594]
NBP2-97507DL594 0.1 mL

Rabbit Polyclonal IER5 Antibody [DyLight 594]

Sign In for Pricing
View Details
SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 405)
MBS6352615-01 0.1 mL

SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 405)

Sign In for Pricing
View Details
SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 405)
MBS6352615-02 5x 0.1 mL

SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 405)

Sign In for Pricing
View Details
Goat IL1b (Interleukin 1 Beta) ELISA Kit
EK250329 96 Well

Goat IL1b (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
BRAF35 (HMG20B) Rabbit Polyclonal Antibody
AP54988SU-N 200 µL

BRAF35 (HMG20B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C10orf112 (MALRD1) activation kit by CRISPRa
GA117502 1 Kit

Human C10orf112 (MALRD1) activation kit by CRISPRa

Sign In for Pricing
View Details