CDKN1B/p27KIP1 Rabbit pAb (APR22199N)
Product Specifications
Background
This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4) .
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDKN1B/p27KIP1 Rabbit pAb (APR22196N2) .
Synonyms
CDKN1B; CDKN4; KIP1; MEN1B; MEN4; P27KIP1; p27 KIP 1
Gene ID
1027
UniProt
P46527
Cellular Locus
Cytoplasm, Endosome, Nucleus
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 22kDa Observed MW: 30kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1027
Uniprot URL
https://www.uniprot.org/uniprot/P46527
AA Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACK
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6307906-01 0.2 mL
Hoxb7, ID (Hoxb7, Hoxb-7, R1b, Homeobox protein Hox-B7, Homeobox protein R1B) (Azide free) (HRP)
Sign In for Pricing
View Details 
MBS6307906-02 5x 0.2 mL
Hoxb7, ID (Hoxb7, Hoxb-7, R1b, Homeobox protein Hox-B7, Homeobox protein R1B) (Azide free) (HRP)
Sign In for Pricing
View Details TA317566 50 µg
S1PR4 / EDG6 Rabbit Polyclonal (C-Terminus) Antibody
Sign In for Pricing
View Details 
362116 200 µL
ANGPTL6 (Angiopoietin Like Protein 6, ARP5, AGF, Angiopoietin-Related Protein 5, Angiopoietin-related growth factor)
Sign In for Pricing
View Details