Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1B/p27KIP1 Rabbit pAb (APR22199N)

Product Specifications

Background

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDKN1B/p27KIP1 Rabbit pAb (APR22196N2) .

Synonyms

CDKN1B; CDKN4; KIP1; MEN1B; MEN4; P27KIP1; p27 KIP 1

Gene ID

1027

UniProt

P46527

Cellular Locus

Cytoplasm, Endosome, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1027

Uniprot URL

https://www.uniprot.org/uniprot/P46527

AA Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csap1 Rat shRNA Plasmid (Locus ID 171161)
TR712751 1 Kit

Csap1 Rat shRNA Plasmid (Locus ID 171161)

Sign In for Pricing
View Details
FBL12 Double Nickase Plasmid (m2)
sc-424404-NIC-2 20 µg

FBL12 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Becn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4460403 1.0 µg DNA

Becn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PRELP, CT (Prolargin, Proline-arginine-rich End Leucine-rich Repeat Protein, SLRR2A) (HRP)
MBS6494241-01 0.2 mL

PRELP, CT (Prolargin, Proline-arginine-rich End Leucine-rich Repeat Protein, SLRR2A) (HRP)

Sign In for Pricing
View Details
PRELP, CT (Prolargin, Proline-arginine-rich End Leucine-rich Repeat Protein, SLRR2A) (HRP)
MBS6494241-02 5x 0.2 mL

PRELP, CT (Prolargin, Proline-arginine-rich End Leucine-rich Repeat Protein, SLRR2A) (HRP)

Sign In for Pricing
View Details
Coconut Cadang-Cadang Viroid (CCCVd) One-Step PCR kit
Oneq-A542-150R-01 150 Reactions

Coconut Cadang-Cadang Viroid (CCCVd) One-Step PCR kit

Sign In for Pricing
View Details