Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1B/p27KIP1 Rabbit pAb (APR22199N)

Product Specifications

Background

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDKN1B/p27KIP1 Rabbit pAb (APR22196N2) .

Synonyms

CDKN1B; CDKN4; KIP1; MEN1B; MEN4; P27KIP1; p27 KIP 1

Gene ID

1027

UniProt

P46527

Cellular Locus

Cytoplasm, Endosome, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1027

Uniprot URL

https://www.uniprot.org/uniprot/P46527

AA Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD74 Antibody (LN-2 + CLIP/813)
NBP3-11423 0.1 mg

Mouse Monoclonal CD74 Antibody (LN-2 + CLIP/813)

Sign In for Pricing
View Details
Vandetanib, Free Base (ZD6474)
V2052 50 mg

Vandetanib, Free Base (ZD6474)

Sign In for Pricing
View Details
Prom1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6856002 1.0 µg DNA

Prom1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Fmoc-Ile-Pro-OH 98+% (HPLC)
238321-01 250 mg

Fmoc-Ile-Pro-OH 98+% (HPLC)

Sign In for Pricing
View Details
Fmoc-Ile-Pro-OH 98+% (HPLC)
238321-02 1 g

Fmoc-Ile-Pro-OH 98+% (HPLC)

Sign In for Pricing
View Details
Fmoc-Ile-Pro-OH 98+% (HPLC)
238321-03 5 g

Fmoc-Ile-Pro-OH 98+% (HPLC)

Sign In for Pricing
View Details