Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calnexin Rabbit pAb (APR22198N)

Product Specifications

Background

This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER) -associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Calnexin Rabbit pAb (APR22196N1) .

Synonyms

CNX; IP90; P90; Calnexin; CANX; calnexin

Gene ID

821

UniProt

P27824

Cellular Locus

Endoplasmic reticulum, Endoplasmic reticulum membrane, Melanosome, Single-pass type I membrane protein

Applications

WB (Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/67kDa/71kDa Observed MW: 90KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=821

Uniprot URL

https://www.uniprot.org/uniprot/P27824

AA Sequence

FCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRX2 Rabbit Polyclonal Antibody
APRab12764-01 20 µL

IRX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRX2 Rabbit Polyclonal Antibody
APRab12764-02 50 µL

IRX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRX2 Rabbit Polyclonal Antibody
APRab12764-03 100 µL

IRX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRX2 Rabbit Polyclonal Antibody
APRab12764-04 200 µL

IRX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DCAF8 Knockout HEK293T cell line
GTR15402765 1 Vial

Human DCAF8 Knockout HEK293T cell line

Sign In for Pricing
View Details
WDR41, CT (WDR41, WD repeat-containing protein 41) (MaxLight 490)
MBS6363253-01 0.1 mL

WDR41, CT (WDR41, WD repeat-containing protein 41) (MaxLight 490)

Sign In for Pricing
View Details