Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrkA Rabbit pAb (APR22187N)

Product Specifications

Background

This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TrkA Rabbit pAb (APR22187N) .

Synonyms

NTRK1; MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA

Gene ID

4914

UniProt

P04629

Cellular Locus

Cell membrane, Early endosome membrane, Late endosome membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa/83kDa/86kDa/87kDa Observed MW: 140kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4914

Uniprot URL

https://www.uniprot.org/uniprot/P04629

AA Sequence

LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1H (NM_015941) Human Recombinant Protein
TP306841M 100 µg

ATP6V1H (NM_015941) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF226 (NM_001032373) Human Over-expression Lysate
LC422312 20 µg

ZNF226 (NM_001032373) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Oncostatin M (OSM) ELISA Kit
RD-OSM-b-01 96 Tests

Bovine Oncostatin M (OSM) ELISA Kit

Sign In for Pricing
View Details
Bovine Oncostatin M (OSM) ELISA Kit
RD-OSM-b-02 48 Tests

Bovine Oncostatin M (OSM) ELISA Kit

Sign In for Pricing
View Details
Hexokinase II Recombinant Rabbit Monoclonal Antibody [PSH08-81]
HA723033 100 µL

Hexokinase II Recombinant Rabbit Monoclonal Antibody [PSH08-81]

Sign In for Pricing
View Details
Ethyl 2-Azidoacetate
TRC-B434168-5G 5 g

Ethyl 2-Azidoacetate

Sign In for Pricing
View Details