TrkA Rabbit pAb (APR22187N)
Product Specifications
Background
This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TrkA Rabbit pAb (APR22187N) .
Synonyms
NTRK1; MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA
Gene ID
4914
UniProt
P04629
Cellular Locus
Cell membrane, Early endosome membrane, Late endosome membrane, Single-pass type I membrane protein
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 77kDa/83kDa/86kDa/87kDa Observed MW: 140kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4914
Uniprot URL
https://www.uniprot.org/uniprot/P04629
AA Sequence
LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042981-100 1x 100 µL
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP20327PU-N 100 µg
Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
LY424559 100 µg
Pancreatic alpha amylase (AMY2A) (NM_000699) Human Over-expression Lysate
Sign In for Pricing
View Details ![p21 Mouse Monoclonal Antibody [A8C11]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b33/imageurl/ha601018.webp)
LY431122 100 µg
SHISAL2B (NM_001164442) Human Over-expression Lysate
Sign In for Pricing
View Details